PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02593.1.g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 1175aa    MW: 125451 Da    PI: 8.44
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02593.1.g00110.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.32e-05839879440
                      zf-B_box   4 rkCpeHeekelqlfCedCqq.llCedCllee.Hkg..Htvv 40 
                                   r+C ++   ++  +C++C+  +lC++C     H g  H++v
  Zmw_sc02593.1.g00110.1.am.mk 839 RRCGLCMAAPAAVHCRSCGGvFLCASCDARPaHAGpgHERV 879
                                   79****************876********999988889865 PP

2zf-B_box24.94.2e-08879924342
                      zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                    ++C+ +e  ++   C+ +   lC+ C   +H+       H++vp+
  Zmw_sc02593.1.g00110.1.am.mk 879 VWVCEVCETAPADVMCKADAAVLCAACDADIHEAnplarrHRRVPI 924
                                   689*****************************77899999**9997 PP

3CCT68.51.8e-2310971140144
                           CCT    1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44  
                                    Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Zmw_sc02593.1.g00110.1.am.mk 1097 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 1140
                                    9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF522831.96E-2497222No hitNo description
Gene3DG3DSA:3.40.50.7202.8E-2297192IPR016040NAD(P)-binding domain
PfamPF003892.5E-20100334IPR006139D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
SuperFamilySSF517355.11E-27184303IPR016040NAD(P)-binding domain
Gene3DG3DSA:3.40.50.7204.9E-26193271IPR016040NAD(P)-binding domain
PfamPF028262.0E-17193266IPR006140D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domain
PROSITE patternPS000650230257IPR029752D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domain conserved site 1
PfamPF028261.7E-6271302IPR006140D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domain
Gene3DG3DSA:3.40.50.7202.1E-10273323IPR016040NAD(P)-binding domain
Gene3DG3DSA:3.30.1330.901.8E-19339486IPR029009Allosteric substrate binding domain
SuperFamilySSF1435489.94E-22340486IPR029009Allosteric substrate binding domain
SuperFamilySSF550214.58E-12482555No hitNo description
Gene3DG3DSA:3.30.70.2605.7E-14487554No hitNo description
PROSITE profilePS5167111.434492567IPR002912ACT domain
CDDcd049023.32E-20492557No hitNo description
PfamPF018427.2E-9493550IPR002912ACT domain
SMARTSM003360.058836881IPR000315B-box-type zinc finger
PROSITE profilePS5011911.035877924IPR000315B-box-type zinc finger
PfamPF006433.3E-6878924IPR000315B-box-type zinc finger
CDDcd000212.16E-8880924No hitNo description
SMARTSM003364.2E-9882924IPR000315B-box-type zinc finger
PfamPF062032.9E-1710971139IPR010402CCT domain
PROSITE profilePS5101716.89610971139IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0016597Molecular Functionamino acid binding
GO:0016616Molecular Functionoxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0051287Molecular FunctionNAD binding
Sequence ? help Back to Top
Protein Sequence    Length: 1175 aa     Download sequence    Send to blast
MVDAGTLSSV AASQRLHFTA RQSHTLLDCA KPMALATPLR LILPVAAAPA MPPDPAGPSF  60
RALPPRRCHL RGSLAAAPSP SPAARTVAAS AAAGAGRPTV LVTEKLGSAG LDLLREFANV  120
DCSYELTTEE LRAKVSLVDA LVVRSATRVS REVFEAARGR LRVVGRAGAA TEVGCLVVNA  180
PTANTVAAAE HAVALIAAMA RNVAQADASL KAGKWQRSKF MGVSLVGKTL AIMGFGKVGS  240
EVARRAKGLG MDIIAHDPYA PVDRARAIGV DLAALDVFTE EPPAKDSKLV HHENVTVTPH  300
LGASTTEAQE GVAVEIAEAV ICALRGDLAA TAVNAPMVPA EVLSELSPYI ILAEKLGRLV  360
VQLVAGGSGI KGVKVVYSSA RDPDDLDTRI LRAMVIKGII EPISSAFINI VNADYVAKQR  420
GLQIVEERIL LDGSQEVPLD SIQVHLANVE SKFAGALSDA GDIRVEGQVK NGTPHLTFVG  480
SFDVDVSLEG NLLLFRQVDQ PGIIGKVGSV LGKMNVNVNF MSVGRTARGK EAIMAIGVDE  540
ELEKEALKLI GFLDAELETS VLRRLGFIPK RKGNARYTDR HSTKAALAKQ GCSMVYCERK  600
KLAVAVASQA TWCGVLGWEQ SARKGDAWLS ILALDSHARR RHEPTCPPPV SVDRKGPSPT  660
NLAKSLTKSS GKFGAGMNCR KIRRKFRVLA ARDAKSFPDR QPHEMTASGS SPGTAVNDAS  720
APVACRGSTR PRWPITVCDY PFIHAKGQPR LVHDADIFLP PPLPTTCASP ATSPSRTYHY  780
MYRASFHYAA PPPSAPLPFP LAIAGANRAE LLATIAKRDR TAPPVTMMEL HKYWGVGGRR  840
CGLCMAAPAA VHCRSCGGVF LCASCDARPA HAGPGHERVW VCEVCETAPA DVMCKADAAV  900
LCAACDADIH EANPLARRHR RVPIAPIGSA AADSMLFGGA AEEEQKETEH EQHSLNLNVE  960
AKDMKLDYLF SDLDPYLNVE LPRFHHADSV VPSGVAVELD FTGGIGVKQP SYSSYTATSL  1020
APSGSSSEVS VVPDALYVGG GHGSFELDFT RPKHQAYIPY TATPPSHSVA SVDAAELVPD  1080
QRGEAFAVPR PVSDEGREAR LMRYREKRKN RRFEKTIRYA SRKAYAETRP RIKGRFAKRT  1140
DTDTDADDAE AEAEADVPKP SSYMLDFGYS VVPSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ygy_A3e-35985425506D-3-phosphoglycerate dehydrogenase
1ygy_B3e-35985425506D-3-phosphoglycerate dehydrogenase
3dc2_A3e-35985425506D-3-phosphoglycerate dehydrogenase
3dc2_B3e-35985425506D-3-phosphoglycerate dehydrogenase
3ddn_A2e-35985424505D-3-phosphoglycerate dehydrogenase
3ddn_B2e-35985424505D-3-phosphoglycerate dehydrogenase